4% in white 96- and 384-well microplates Sensitivity (ATP-Glow) Optimized 96 wells 3 pM 384 wells 6 pM. 8 (W) x 15 (D)This SpectraMax Plus 384 Spectrophotometer has been sold, but you can view our other spectrophotometers currently available for purchase here: Plus384, 190, 340PC384, and VersaMax Installation Guide Author: Molecular Devices Subject: Installation Guide Keywords: SpectraMax Versa and others Detection Platform Created Date: 5/17/2023 2:14:27 PMOn SpectraMax L, 1 RLU = 1 count per second for photon counting mode only. The SpectraMax® Plus 384 adds the ability to read cuvettes. Regularly used for NADPH ATPase assays, and BCA assays. Meso Scale Discovery 1250 Sector Imager 2400. used. Table 2. The optical performance is comparable to a top-of-the-line dedicatedUnparalleled performance on a personalized platform. SPECTRAmax PLUS Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific pro-teins, nucleic acids, and other molecules across a wide range of concentrations. UV/Vis spectrophotometer & microplate reader with built-in cuvette port. SpectraMax Microplate Readers. 과 같은 Parameter를 검사하여 평가할 수 있습니다. Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax GEMINI EM. In addition, the SpectraMax iD5 The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution to help you expand the boundaries of your research capabilities. SpectraMaxi3xMulti-ModeDetectionPlatformUserGuide 26 5039228DOther things to consider include plate format – 96-well and 384-well plates are the norm but higher and lower capacity plate sizes are also available, speed and throughput needed, type of software, and whether or not multiple plates or wells can be read simultaneously. With the SpectraMax® MiniMax™ 300 Imaging Cytometer, industry-leading SoftMax® Pro Software, and user. Multichannel optical design. Fluorescence filters included in 1nm range. Assay Kits. General-purpose refrigerators are ideal economical units for when precise temperature control and maintenance are not. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. For high-range or. The SpectraMax Paradigm Multi-Mode Detection. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. In these readers, RLUs are proportional to counts/sec which doesn't change with. Set up SoftMax Pro Software to use PathCheck as detailed above. Annual recertification of your validation plates ensure that they meet specifications and give you confidence in the performance of your instrument. Lids for a case of 200 microplates must be purchased separately. The plate reader optics are. Wavelength Selection. Computer and software not available. Page 19: Plate Adapter SpectraMax M2 and M2e Microplate Reader User Guide Plate Adapter Before you read standard 96-well or 384-well plates from the top, you must insert the plate adapter in the plate drawer. The optical performance is comparable to a top-of-the-line dedicatedThe SpectraMax 190 reader is the tool for DNA analysis. TheSpectraMax®Plus384addstheabilitytoreadcuvettes. Qualify the absorbance performance of SpectraMax® iD3, iD5, i3, i3x, M2, M2e, M3, M4, M5, M5e, Plus 384, ABS, ABS Plus, and FlexStation 3 readers. SpectraMax Plus 384 Spectrophotometer from Molecular Devices LLC. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Our microplate readers and software are the industry’s most cited and have empowered life science researchers to advance protein and cell biology. Shaker time: 0 to 999 seconds Temperature control: Ambient +4°C to 45°C Temperature. VersaMaxreads96-wellplates. Reference diodes enable elimination of measurement noise due to slight fluctuations in. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselected wavelengthsinasinglereadmode. where. 6 (H) x 22. With optimized reagents and the industry-leading data acquisition and analysis tool SoftMax® Pro 7 Software, the SpectraMax iD3 allows you to customize your workflow to. The PA 800 Plus system is a robust analytical, kit-based platform that can help you with: Purity/Heterogeneity with gold standard CE-SDS in minutes. The adapter isThe SpectraMax Paradigm Multi Mode Detection Platform utilizes a patent pending design that allows for real time system configuration by the user in less than two minutes. Temperature control. 5 cm x. Shaker time 0 to 999 seconds Temperature range Ambient +4°C to 45°C General specifications Dimensions (in. Fluorescent detection is achieved from the top, through the entire depth of sample in the microplate well. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. When you do a read at wavelengths below 340 nm, you must use special UV-transparent, disposable or quartz plates to allow transmission of the deep UV spectra. spr * SpectraMax i3(x) SpectraTest ABS2 v1. The SpectraMax Paradigm Platform was able to quantify the protein down to the low picomolar level using an AlphaLISA method (Figure 1). Page 12 Chapter 1 SpectraMax GEMINI EM Operator’s Manual. Simply select the absorbance maximum of a sample and let the monochromator tune to that exact wavelength. For very concentrated samples, use a minimumThe ProcartaPlex 384-well format was specifically developed to increase sample throughput while maintaining the robustness of a 96-well assay. Made from polypropylene with conical well profiles to maximize recovery and allow working with sample volumes as low as 5 µl. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). In the M2, M5 and Plus 384, the light. The plate reader optics are tunable for absorbance, fluorescence intensity, fluorescence polarization, and time resolved fluorescence assays (TRF). 1, All Necessary Cables and Cords, Manuals. Measurement of tannin, iron-reactive phenolics, anthocyanin and polymeric pigment in red wine is an important part of quality control in the wine industry. Shaker time 0 to 999 seconds Temperature control Ambient. Item SpectraMax Plus 384 Microplate Spectrophotometer. These VWR® Plus Series stainless steel refrigerators feature a multi-functional design for laboratory use. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. DNA provides the same sensitivity as a spectrophotometer. Use any standard cuvette, 12 x 75 mm test tube, 96- or 384-well. 0nm increments. The AquaMax® Microplate Washer is a fully self-contained system, configurable for both 96- and 384-well microplates. Page 1The Molecular Devices SpectraMax M2 Microplate Reader is a multidetection microplate reader with dualmonochromators, dual-mode cuvette ports, and top-reading capability. Read up to 6 wavelengths in endpoint or kinetic mode for 96- and 384-well plates, and perform spectral scans to determine. spr SpectraMax iD3 SpectraTest ABS2 v1. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. On LabX buyers can find a variety of SpectraMAX models for sale: 190, 384, 340 and the SpectraMAX M series. Company Molecular Devices LLC. 314 low lamp level warning. 384-well microplate for use in time-resolved fluorescence, luminescence, Alpha, and radiometric assays. Temperature control and shaking included as standard. 316 grating motor driver faulty. 100 fmol 1536-well (8 µL) 0. The SpectraMax 384 Plus lets you get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. 6 to 384-well plates, LVis Plate with sixteen 2 µL microspots; Get Quote. Page 14: Component Description† Bottom mounting for SpectraMax Paradigm Readers only. spr SpectraMax Plus 384. Learn how to operate the VersaMax, SpectraMax 340PC384 and SpectraMax 190 Plus384 microplate readers, which offer fast and accurate absorbance measurements for a. Shaker time 0 to 999 seconds Temperature control Ambient. Digital controller and display. Multimode Reader Comparison Chart. ester flash assays, in both 96- and 384-well plates. Select ‘Water Constant’ in the Instrument Settings dialog box (Figure 3). TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytesacross awiderangeofconcentrations. SpectraMax190reads96-wellplates. 3) This warranty covers the SPECTRAmax PLUS 384The SpectraMax 384 Plus UV/Vis Microplate Reader is manufactured by Molecular Devices. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. The optical performance is comparable to a top-of-the-line dedicatedDescription Microplates The SpectraMax Multi-Mode Microplate Reader can accommodate SBS- standard 6-well to 384-well microplates and strip wells. The optical performance is comparable to a top-of-the-line dedicatedSpectraMax M Series Multi-Mode Microplate Readers 3. The SpectraMax® Glo Steady-Luc™ Reporter Assay Kit provides a highly sensitive assay for the quan-titation of firefly luciferase expression in mammalian cells. Double-click the unknown device with the yellow warning icon. Stand alone mode is not available for the VersaMax. Detection modalities are shown in Table 1-1. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. For more sample throughput, the system can be. BioRAPTR FRD Microfluidic Workstation and SpectraMax Paradigm Multi-Mode Detection Platform” PART NUMBER: 0200-7017 0200-7018 0200-7019 (384 Std) (384 HTS) (1536 HTS) Plate 96, 384 96, 384 96, 384, formats 1536 Typical 4 min/ 384 2 min/384 8 min/1536 Throughput plate plate plate Fully enabled protocols = reduced setup timeThe SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. 3) This warranty covers the SPECTRAmax PLUS 384384-well clear-bottom, scintillating microplate for cell-based radiometric proximity assays. Customize data collection and analysis. Multimode Readers Comparison Chart. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselectedwavelengthsina singlereadmode. If desired, a high-range standard curve may be prepared from 1 ng/mL to 1 μg/mL, or a low-range standard curve may be prepared from 25 pg/mL to 25 ng/mL. View and Download Molecular Devices SPECTRAmax PLUS 384 operator's manual online. SpectraMax® M2 and M2e Microplate Readers are the standard for UV/visible multimode reader absorbance, providing ultrafast and full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. Review date: 12 Jun 2017 | SpectraMax Plus 384 Microplate Reader Get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. . This UV-visible absorbance microplate reader provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. AlphaScreen and AlphaLisa detection using a 680 nm excitation laser diode and a 570/100 nm emission filter. spectramax id3 multi-mode microplate reader, spectramax id3, softmax pro 7 software, spectramax id3 injector system. Charge heterogeneity with fast and simple CZE or with hi-res cIEF. Other recommended products. The optical performance is comparable to a top-of-the-line dedicatedSpectraMax 340PC384的光学设计真实地模 拟双光束分光光度计。每个孔有其各自的 样品光束检测和参比检测。8通道的系统， 包含8条样品检测光束和8条参比光束，给 予出众的精确度和高速读板方式。 不需要滤光片 SpectraMax 340PC384使用光栅单色器代替 滤光片。Explore more about Optimized settings for Transcreener TR-FRET assay on SpectraMax iD5 and SpectraMax i3x readers. Molecular Devices SpectraMax Plus 384. It is upgradeable to include a barcode reader,. 2. The SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers measure absorbance, fluorescence, and luminescence. Page 78 SpectraMax iD3 Multi-Mode Microplate Reader User Guide 4. Molecular Devices Spectramax 384 Plus Microplate Reader is available from The Lab World Group. Optimal volumes are usually stated as 'working volume', which is 25 - 90 mL. 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. Assay setup for a 384-well low-volume plate. The eight-channel system delivers both high precision and speed when reading 96- and 384-well microplates for endpoint measurements, kinetic assays, and spectral scans. The optical system of the SpectraMax 340PC384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for. , FI 45 sec. Other technologies such as imaging. For fluorescence intensity assays, the SpectraMax® M2 and M2e units feature an. SpectraMax 190 reads 96-well plates. 76358-624. Check: In the data table create two new columns and add the following formulas: !Pathchecklm900. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. Industry-leading SoftMax® Pro Microplate Data Acquisition and Analysis Software eliminates the need to export data The SpectraMax ABS Plus, can accommodate standard 96-well plates and 384-well plates. Expand your research capabilities to include flash-based applications, including dual luciferase and ATP assays. Or, with the reader specifications noted from the Instrument Description section of your reader's manual, as well as those for your PC, you can calculate needs more closely. The minimum order for this item is . Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. It may be named "Pothos". . There should be a value for 900 and 1000. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. 4. Using the patented PathCheck® Pathlength Measurement Technology, the SpectraMax M5e Microplate Reader transforms each well in a microplate to a fixed. The light transmittance was evaluated as function of wavelength of the BNC membranes. The LMax plate reader has similar calculations and its RLUs are comparable to those of LMax II 384. Page 13: Introduction Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax GEMINI EM. The SpectraMax ABS Plus Microplate Reader can run both cuvette-based and microplate based reader applications on the same instrument. Molecular Devices SpectraMax 384 Plus Microplate Reader Specifications. When you do a read at wavelengths below 340 nm, you must use special UV-transparent, disposable or quartz plates to allow transmission of the deep UV spectra. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Five-mode microplate reading with superior optics Unique optical characteristics 1. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Absorbance = E * C * L. reader in the visible range between 405–750 nm with NIST and NMI. Fluorescence Intensity top and bottom capabilities. The SpectraMax iD3 reader is fully compatible with the SpectraDrop™ Micro Volume Microplate, enabling quantitation of precious low volume samples. Such cross talk can occur through the wall of a white 384 well microplate. Every step is optimized for data acquired from a Molecular Devices microplate reader or data imported from. Glad to help you. Molecular Devices SpectraMax 384 Plus Microplate Reader. This UV-visible absorbance microplate reader provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. The SoftMax® Pro Data Acquisition and Analysis Software controls Molecular Devices® spectrophotometers and absorbance, luminescence, and fluorescence microplate readers andThe absorbance at 450 nm was measured with a microplate reader (SPECTRAmax 384, Molecular Devices, United States). Analyst, M5, Flex 3, and SpectraMax L readers work differently. Supplier: Molecular Devices. Molecular Devices would like to introduce to you the SoftMax Pro 7, software designed to provide the simplicity, flexibility and power required for advanced. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). 7. Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SPECTRAmax GEMINI XS. The SpectraMax® M5 Multi-Mode Microplate Reader delivers single mode reader performance and can be equipped to read volumes as low as 2uL in one multimode reader package. Experienced in operating and performing maintenance on numerous laboratory instrumentation from various large and small manufacturers including Spectramax 384 and i3 with Softmax software. 305 reference level saturation. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate. SpectraMax M2, M2e; SpectraMax M3, M4, M5, M5e; FilterMax™ Multi-Mode Detection Platform. The 1/absorptivity value for double stranded DNA at 260 nm is commonly assumed. 5065390D 3 Contents SafetyInformation 4 Warnings,Cautions,Notes,andTips 4 Chapter1:Introduction 7 ComputerIntegration 8 PlateControls 9 CuvetteChamber 10Multimode Reader Comparison Chart. The SpectraMax Plus 384 Microplate Reader gives users the convenience of both standard spectrophotometer and microplate reader applications on the same instrument. Spectramax i3 manual. Microplates for applications that require high sample recovery rates. Wavelength Range. GETTING THE MOST FROM YOUR MOLECULAR DEVICES MICROPLATE SYSTEMS applications guide to microplate systems applications guide to microplate systemsSPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. Molecular Devices UVmax Kinetic Microplate Reader. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. SpectraMax® M2 Multi-Mode Microplate Reader MLDVM2 SpectraMax® M2e Multi-Mode Microplate Reader (top and bottom reading) MLDVM2E SpectraMax® M3 Multi-Mode Microplate Reader MLDVM3 Ordering information VWR cat. Page 10 Cuvette Chamber The cuvette chamber on the SpectraMax Plus 384 is located at the right front of the instrument. SpectraMax i3x Injector Cartridge with SmartInject® Technology. TNF standard curve. Flexible Template Assignment (Figure 1) to customize assays exactly to user specifications. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Features. plates < 100 amol (384-well) 1. Temperature control and microplate-shaking included. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. The user must ensure that the meniscus is comfortably above the light beam in standard cuvettes and that the sample chamber in a microcuvette is aligned properly with the beam. 더 많은. The SpectraMax Plus 384 reader is equipped with an innovation patented by Molecular Devices, the PathCheck® sensor, which measures the depth of a sample in a microplate by optical path length. Pick the best speed, sensitivity, and price for your needs. Expanded dynamic range Engineered for performance with spectral fusion illumination for increased sensitivity across the entire excitation range. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. 2 pM 2 pM 384-well (50 µL) 3 pM 4 pMThe SpectraMax i3 Multi-Mode Detection Platform is a versatile instrument that can perform various assays and measurements on microplates and cuvettes. SpectraMax iD3 and iD5 Register or Sign In. The Spectramax 190 has an array of data collection modes, including kinetic, endpoint, and spectral scan modes. The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentrations. A microplate reader that can detect two or more applications is considered a multi-mode plate reader. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. and detection of plate formats from 6- to 384-wells, the SpectraMax iD5 reader is the complete solution for all your research needs. The SpectraMax Vertical 1000 is available for purchase online and comes with a five-year warranty. Time Resolved Fluorescence. The plate reader optics are tunable for absorbance, fluorescence intensity, fluorescence polarization, and time. The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution designed to expand the boundaries of research capabilities. Call me at Phoenix Equipment in Rochester. Detection modalities are shown in Table 1-1. Manufacturer: Molecular Devices Model: SpectraMax Plus 384 The SpectraMax ® Plus 384 Microplate Reader can run both standard spectrophotometer and microplate reader applications on the same instrument. Each sample has a discrete sample beam and reference beam. Microplate Spectrophotometer. SpectraMax® iD3, iD5, ABS, and ABS Plus readers, and up to 2. Microplate spectrophotometers, also called microplate readers, allow researchers to analyze multiple samples in parallel using 6- to 1536-well formats, as opposed to single sample measurements. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. Multimode Readers Comparison Chart. 2. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 1000 nm). If using a microplate, place it in the drawer of the SPECTRAmax PLUS, then read the plate. The narrow bandwidths used by the model increase measurement accuracy and linearity over a wide. View the LabX ads below to find Molecular Devices SpectraMAX plate readers for sale and. Microplate Readers. 6 (H) x 22. SpectraMax Spectrophotometers for UV-Vis Absorbance Detection. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. SpectraMax ABS Plus reader utilizes Molecular Devices PathCheck Sensor- the only patented technology. Videos & Webinars. 5 pM 2. Paradigm spectramax manualslibSpectramax id5 Molecular devices spectramax plus 384 user manual pdf downloadShaking spectramax id3 frequently. Regularly used for NADPH ATPase assays, and BCA assays. Absorbance: For wavelengths in the visible range, 340 nm and above, clear polystyrene plates are recommended. We would like to show you a description here but the site won’t allow us. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. Detection modalities include absorbance (UV-Vis. The EMax® Plus Microplate Reader is designed to be a versatile and robust plate reader for research laboratories. both cuvette-based and microplate reader applications on the same instrument. SpectraMax Spectrophotometers for UV-Vis Absorbance Detection. The SpectraMax® M2 and M2e Systems from Molecular Devices are multidetection microplate readers with dualmonochromators, dual-mode cuvette ports, and top- and bottom-reading capability (top-reading only on the M2). and detection of plate formats from 6- to 384-wells, the SpectraMax iD5 reader is the complete solution for all your research needs. SpectraMax 340PC384: SpectraMax Plus384: VERSAmax: Vmax: Tecan: Sunrise: Trinean: DropSense96: AMBIENT TEMPERATURE STORAGE: Liconic: LPX 220 Hotel: LPX 440 Hotel:. Three low volume 24-well bottom slides. Sold as-is. Before you do a bottom read, or use high profile (6-well, 12-well, 24-well, or 48-well) plates, you must remove the plate adapter from the plate drawer. Categories:. SpectraMax Gemini XPS/EM Register or Sign In. Key applications**. For more sample throughput, both readers can be easily integrated into full roboticThe SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research capabilities and comes with built-in absorbance, fluorescence, luminescence, time-resolved fluorescence (TRF), and tunable fluorescence polarization (FP) read modesRobust, high-value microplate readers that can run samples. The SpectraMax® M3 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. Molecular Devices recommends that you use high-quality, doubleshielded cables to connect your SpectraMax. SpectraMax i3x. 00 USDThe SpectraMax® M2 and M2e Systems from Molecular Devices are multi-detection microplate readers with dual-. The AlphaScreen Detection Cartridges utilize a 680nm Laser Diode to provide a sensitive reading system for AlphaScreen assays. More Product Information. SpectraMax® Absorbance Microplate Readers can run both cuvette-based and microplate reader applications on the same instrument. The technology allows automatic adjustment of good absorbance to a tube equivalent path length of 1 cm, converted to 96 or 384 tubes. For more sample throughput, both readers can be easily integrated into full roboticMode 96-Well 384-Well 1536-Well Optimizedforspeed 20 seconds 33 seconds 68 seconds Optimizedforperformance 28 seconds 45 seconds 96 seconds Stop-and-go(off) 41 seconds 2 minutes <5 minutes. Typical applications for this powerful reader include DNA and RNA quantification. SoftMax Pro Software, the industry-leading microplate reader software for the SpectraMax Plus 384 system, allows complete customization of data collection and analysis. With optimized reagents, option to operate the. Explore how the SpectraMax i3 Multi-Mode Platform provides an unlimited breadth of application possibilities, and how it can evolve with your future needs. SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. Molecular Devices Spectramax 384 Plus Microplate Reader. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. For wavelengths in the UV range above 220 nm,. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Spectral Range. Robust. The . Service parts for these models are not being produced and are no longer in stock. The SpectraMax® M3 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. Products : FlexStation 3 reader, SpectraMax M5/M5e reader, SpectraMax M2/M2e reader. spr SpectraMax iD5 SpectraTest ABS2 v1. Page 6 SpectraMax Plus384, 190, 340PC384, and VersaMax Installation Guide Connecting Instrument Cables The power cord and USB cable connect to the ports on the rear of the instrument. Review date: 12 Jun 2017 | SpectraMax Plus 384 Microplate Reader Get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. Corning® EcoChoice™ products are produced, packaged, and/or distributed in an environmentally friendly manner following United States Government Federal Trade Commission (FTC) Guidelines Learn More. The low profile increases robotic stack capacity and storage. Detection modalities are shown in Table 1-1. 96 wells 384 wells Absorbance 0:30 1:40 Fluorescence intensity 0:25 1:25 Luminescence 0:30 1:15. The SpectraMax® M2 and M2e Systems from Molecular Devices are multi-detection microplate readers with dual-. Statistics. ) gap between the rear of the instrument and the wall. BOE offers an extensive inventory of competitively priced Lab Equipment. SpectraMax 340PC384 reads 96-well plates and 384-well plates. . Model is Spectramax Plus 384. . Perform your favorite applications with a user-friendly reader that accommodates plate types from six to 384-well formats; up to. Detection modalities are shown in Table 1-1. The SpectraMax reader’s optical system mimics a dual-beam spectrophotometer. The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentrations. All have an optical pathlength of 1 cm (10 mm) and standard external dimensions (12. SpectraMax ® Plus 384 optics. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 1000 nm). An ATP standard curve spanning five decades was run using the ATPlite 1step Luminescence Assay System (PerkinElmer) on the SpectraMax iD3 reader. SpectraMax® Quant™ dsDNA Assay Kits The SpectraMax® Quant™ dsDNA Assay Kits are designed for fluorescence-based dsDNA quantitation across a broad range of concentrations. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. 997 (n = 3). Get the best deals for spectramax plus 384 at eBay. Molecular Devices SpectraMax 384 Plus Microplate Reader Specifications. Wavelength range: Excitation: 250-850 nm, Emission: 360-850 nm. SpectraMax® ABS Plus microplate reader can run both cuvette-based and microplate reader applications on the same instrument. The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. Clearance . Applications. Key features 4 wells: 76 seconds Luminescence Specifications Dynamic Range < 6 decades Sensitivity 10 amol ATP General Specifications. In case of a cuvette, the optical path is horizontal, hence. o SpectraMax M2 - Instrument boot-up problem while connected to SoftMax Pro has been fixed o LMax II - Fast Kinetic read mode button icon is fixed to show the selected state. 030 fmol Fluorescence Polarization (FP). SpectraDrop High-Throughput Screening (HTS) Kit. to View Figures. Beer-Lambert Law states that. 1) All parts of the SPECTRAmax 340PC 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. 1. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time. 6-, 12-,. Labsystems Nepheloskan Ascent Microplate Reader. Key features 4 gain calibration failed. The SpectraMax ® Plus 384 Microplate Reader gives you walk-up convenience for both standard spectrophotometer and microplate reader applications on. Molecular Devices SpectraMax 384 Plus Microplate Reader. Keywords: spectramax m2 systems, spectramax m2e systems, spectramax m2/m2e readers, pathcheck sensor, spectratest abs1 absorbance, stakmax stacker Created Date: 5/20/2019 9:24:38 AM SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. We have a great online selection at the lowest prices with Fast & Free shipping on many items!384-well (75 µL) 0. Which SpectraMax Multi-Mode Microplate Reader do you need? Detection Modes Absorbance Fluorescence Intensity Luminescence Time-Resolved Fluorescence Fluorescence Polarization HTRF Upgrade Options Plate Formats 6-, 12-, 24-, 48-, 96-, 384-Well Microplates Certification and Validation IMAP Validation (TR-FRET only) (TR-FRET. Reads standard cuvettes & 96-384 well plates from 190 to 1000 nm. Product Specs. SPECTRAmax PLUS 384 measuring instruments pdf manual download. AlphaScreen assays cannot be done on the SpectraMax M series, Gemini, and SpectraMax iDx (iD3/iD5) readers. 1) All parts of the SPECTRAmax PLUS 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. 9. used. What is the minimum well volume needed to run a 384 well plate? Minimum volume depends on the solution (curved vs. Table 2 summarizes the results for the uniformity test. Transcreener® HTS is a universal, high throughput biochemical assay platform based on the detection of nucleotides, which are formed by thousands of cellular enzymes—many of which catalyze the covalent regulatory. SpectraMax®Plus384 SpectraMax®190 SpectraMax®340PC384. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Here, the CVs for each plate were less than 3, and the difference between mean onset time for the plates run on the two readers was only 7%. The standard 8 filter modes enable endpoint and kinetic applications such as protein quantification, cell viability and ELISA. 020 fmol 0. The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research capabilities and comes with built-in absorbance, fluorescence, luminescence, time-resolved fluorescence (TRF), and tunable fluorescence polarization (FP) read modes. Detection modalities are shown in Table 1-1. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Time Resolved Fluorescence: Solid white plates for top reads and white plates with clear bottoms for bottom reads. Narrow bandwidths deliver increased measurement accuracy and linearity over the widest range of assays, including. </p> <p>Tissue-culture treated microplates are supplied with lids except when supplied in a case of 200 microplates. For more information, please visit us at Devices – Spectramax Gemini XS plate reader (Fluorescence) Molecular Devices – Spectramax 384 plus plate reader (UV/VIS) Invitrogen by Life technologies Qubit 2. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. 1. Tb donor/red acceptor. Abs 49 sec. Shaking capabilities. The SpectraMax® ABS Plus Microplate Reader can run both cuvette-based and microplate reader applications on the same instrument. Please see part number 6007619, sterile,. Published Dec 16, 2020 | Updated May 19, 2023. A preconfigured protocol with optimized reader settings enabled reading of a 384-well plate in just two minutes. Minimum volume and maximum throughput with 96- or 384. The top- and bottom-reading Gemini EM Microplate Reader with dual monochromators lets users determine the optimal excitation and emission settings for creative new fluorescence. 滤光片型光吸收微孔板读板机（酶标仪），简单易用，性价比高，检测结果精确. Instrument design, user interface capabilities, and cost play key roles in purchasing a suitable microplate reader. Includes: Computer Loaded with SoftMax Pro 5. Wavelength Selection: Monochromator, tunable 1. Molecular Devices SpectraMax i3 Multi-Mode Microplate Reader Pred i3x - AV $14,995. ® reader to the computer. The guidelines for cuvette use in SpectraMax instruments are the same as those that apply to any high-quality spectrophotometer. All data were generated from at least three independent experiments (n ≥ 3). Contains one microplate adapter, five 24-well low volume slides, five 64-well low volume bottom slides, and five of each cover slide (2 µL and 4 µL) 0200-6267. 0 nm increments. the SpectraMax iD3 is a fantastic plate reader for a wide range of. If no values are present, the water constant values are missing from the NVRAM. Create custom fluorescence assays without having to purchase expensive filter sets. SpectraMax M5. With optimized reagents and the industry-leading data acquisition and analysis tool, SoftMax Pro® 7 Software, the SpectraMax® iD3 allows users to customize workflow to perfectly. Data can be analyzed and combined from different plates. Glycan analysis with award-winning Fast Glycan technology. 1: SpectraMax Plus 384 components. With its dual high-velocity liquid injectors, SpectraMax L can perform both flash and glow luminescence detection applications in 96- and 384-well formats with ease. Molecular Devices SpectraMax Plus 384. 0112-0115J 9 Chapter1:Introduction TheSpectraMax®M3Multi-ModeMicroplateReader,SpectraMax®M4Multi-ModeMicroplate Reader,SpectraMax®M5Multi-ModeMicroplateReader,andSpectraMax®M5eMulti-ModeNote: for SpectraMax microplate readers without a cuvette port, the water constant is automatically used in PathCheck calculations, and no Water Constant option appears in the Instrument Settings. A & K Biosource are the pros on this, but these plate readers are quite expensive to repair/calibrate. 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. Learn more about its features, specifications, and applications in this user. Fluorescence Microplate Reader Comparison Chart. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). PathCheck sensor corrects optical pathlength & pipetting variation.